SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT31252 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EMT31252
Domain Number - Region: 120-152
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00053
Family B3 DNA binding domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT31252
Sequence length 154
Comment pep:novel supercontig:GCA_000347335.1:Scaffold4612:61124:63270:1 gene:F775_01688 transcript:EMT31252 description:"Uncharacterized protein "
Sequence
MKVEVKRMSIQSISSALLQMLPNFLLTFIQLNPGTPGRIQHCGELDDHCYWGNEVKLYQW
HVGALFAMFLRKKPGINYYVCTINKTFAKLGQRMNLLDYIDPHNDTLMVKLANGCLLARC
RIMLETDKRTTITTVWSEFRRRANIREGDVCVAI
Download sequence
Identical sequences M8CUI0
EMT31252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]