SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT31332 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT31332
Domain Number 1 Region: 151-257
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.05e-29
Family B3 DNA binding domain 0.0000172
Further Details:      
 
Domain Number 2 Region: 60-107
Classification Level Classification E-value
Superfamily DNA-binding domain 0.000000000288
Family GCC-box binding domain 0.0023
Further Details:      
 
Weak hits

Sequence:  EMT31332
Domain Number - Region: 276-318
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.0288
Family Glutamine synthetase, N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT31332
Sequence length 333
Comment pep:novel supercontig:GCA_000347335.1:Scaffold4429:10843:12401:1 gene:F775_20035 transcript:EMT31332 description:"AP2/ERF and B3 domain-containing protein "
Sequence
MGVEILSSTVEHYSQYSSSASTATTESGAAGRSPMALSLPVAIADESVTSRSTSAQLALS
RFKGVVPQPNGRWGSQIYERHARVWLGTFADQDLAARAYDEAELAFLAAHSKAEIVDMLR
KHTYADELRQGLRRGRGMGTRAQPTPSWAREPLFEKAVTPSDVGKLNRLVVPKQHAEKHF
PLKRTPETTTTTGNGVLLNFEDGEGKVWRFRYSYWNSSQSYVLTKGWSRFVREKGLAAGD
SIVFSCSAYGQEKQFFINCKKNTTVNGGKSASPLPVVETAKGEQVRVVRLFGVDIAGVKR
GRAATAEHGPPELFKRQCVAHGQHSPALGAFVL
Download sequence
Identical sequences M8CUQ6
EMT31332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]