SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT31390 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT31390
Domain Number 1 Region: 153-312
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.57e-40
Family B3 DNA binding domain 0.0045
Further Details:      
 
Domain Number 2 Region: 902-964
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000736
Family PB1 domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT31390
Sequence length 989
Comment pep:novel supercontig:GCA_000347335.1:Scaffold4386:204719:209512:-1 gene:F775_17365 transcript:EMT31390 description:"Auxin response factor 11 "
Sequence
MAAASQEKQQQLLPTFGVLRNAAALLDEMQLMGEAQGAKKVINSELWHACAGPLVCLPQR
GSLVYYFPQGHSEQVAATTKKTPNSRIPNYPSLPSQLLCQVHNITMHVRLLGSSSGSGVG
ADKDTDEVYAQMTLQPVNSETDVFPIPSLGSYAKSKHPAEYFCKNLTASDTSTHGGFSVP
RRAAEKLFPQLDYSMQPPNQELIVRDLHDNMWTFRHIYRGQPKRHLLTTGWSLFVGAKRL
KAGDSVLFIRFPLGEFVRVERPFLTKVTGFRDEKSQLLVGVRRATNQQTALSSSVLSTDS
MHIGVLAAAAHAASSGSSFTIYYNPRTSPSPFVVPVARYNKANYIQQSVGMRMAMMFETE
ESSKRRYTGTIVGVSDSDPMRWPNSKWRNLQIEWDEHGYGERLERVSIWDIETPENTIVF
PSASLNSKRQCLPGYGVPGLDIASVNMSPFQRAPGNPYGNLPHMPAVGSELAMMMFLNQS
GQNMGTPLSCHQSSYSSIIQNVKQNYMPPSTFGHPIGSIKPESMPSNEAQQQQLHAPKMQ
RGDSESCEVQPAADSVSASELHVAGREPRNTDKYPSQSISEQNGKGEPRVKPRRSKKGSS
RKTISENSELSSAPSRICDDQQHVSEAELVSCDTKHVNCGNNEGSSGALTHGDFAGQLQC
QQVEQNELVSPPKLESSISPDGGKSVNSFPNQASFSQFFDGLDWMVQPPNYQDSNGIQSV
SASENIFSPSANIGSTINTDTLETFQNSCLSDCFPNSIQDFIGSPDLHSLTFLSPEMQNL
DVHHDGSNVPSTSNSYVQMSFSEDDSGNHMESMQRGMNNISSCSQPQTTEGFNLGMYSKL
PSLKESQVLSLPEIHNSSRGTSSCSMDAAEYSIGRSAKPMKPPVRTYTKVQKLGSVGRSI
DVTRYRDYRELRSAIASMFGLQGKLEHPASSDWKLVYVDYENDVLLVGDDPWEEFINCVR
CIRILSPSEVQQMSENGMQVLNDCIQADQ
Download sequence
Identical sequences M8C287
EMT31390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]