SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT31591 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT31591
Domain Number 1 Region: 107-248
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.09e-36
Family B3 DNA binding domain 0.0016
Further Details:      
 
Domain Number 2 Region: 593-669
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000181
Family PB1 domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT31591
Sequence length 700
Comment pep:novel supercontig:GCA_000347335.1:Scaffold4063:204630:208280:-1 gene:F775_21871 transcript:EMT31591 description:"Auxin response factor 1 "
Sequence
MAQPGRGRDPELFAELFVKYSTWSNFDPKYAKQKKYFLQGHLEQLQEPTDSALLAEQIKM
FQVPYKILCKVVNVELKAEAETDEVYAQITLQPESDQDNLPLICDPILPETPRPVVHTFC
KILTPSDTSTHGGFSVLRRHANECLPPLDMAMPTPTQEIISKDLHGSEWRFKHIYRGQPR
RHLLTTGWSTFVTSKKLMAGDAFVYLRSETGEQRVGVRRLVQKQSTMPASVISSQSMHLG
VLASASHALKTNSIFVVYYRPRLSQSQYIVSVNKYLQASKTGFTVGMRFRMNFEAEDVPV
KKFFGTIVGDGDLSPQWSGSEWKSLKVQWDDSVAICNGPERVSPWEIDSSDGSSPAISAL
LQSSAKNKRPRETNENFDLPSQEPTQEFWLSGMTQQHERTYVGSSDPNRISGYHQILWPS
SEPAGYGAMSSSSVCQTPLGLGDGWPKDFNPSSQGISPTLSEITQKLNRVASSEGRTPPP
WATALCGGYRAEEPTSKLSCNTTLPLPEQVAPYLPKVAEKAKEPGVVRLFGVNLMENTNN
AAAPTAGNASAGAGETSARVAGSVEGSGQLSAFSKVTKVANESPREIQSQQNNAGRNRVK
VQMHGNAVGRAVDLASLDGYEGLTSELEQMFEIKDIKQNFKVAFTDNEGDTMKVGDDPWM
EFCRMVRKIVIYPIEDDKNMDPRQTSVLAAAPDPDPKANL
Download sequence
Identical sequences M8D5F1
EMT31591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]