SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT31756 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT31756
Domain Number 1 Region: 163-321
Classification Level Classification E-value
Superfamily Mannose-binding lectins 7.33e-24
Family Mannose-binding lectins 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT31756
Sequence length 328
Comment pep:novel supercontig:GCA_000347335.1:Scaffold3814:23189:25121:1 gene:F775_10201 transcript:EMT31756 description:"Uncharacterized protein "
Sequence
MARFNGATVLLIISATVSVYTCAIIAGAALGRTLDSTATTKQTPSDRTLRVSVSFRGLAE
DFAKELWGGNHREGRSGRGLAGAGDGTAVLSSSPASVSLSPRANRAAAADRESALQPMPV
ANYTQVNSRARDDVHTRAAARPWSRRSNFSDEITDEKRPGGRGVIKVGPWGGSGGAPFYM
RGGRGVSAPRVRSVTLQYTDDAIHSFSQSSDEAMVKQTLQRAEGGGQGRARLTLEILVTK
LSSVTQLVTDSINDKNPIIRCYVRAVVVTSLTFRTDKGRTYGPYGKETGTPFSIPAANGC
IVGFWGRSGWLLDAIGVYIRPCQALMAA
Download sequence
Identical sequences M8D5X2
EMT31756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]