SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT31970 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT31970
Domain Number 1 Region: 1-107
Classification Level Classification E-value
Superfamily Mannose-binding lectins 6.67e-23
Family Mannose-binding lectins 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT31970
Sequence length 117
Comment pep:novel supercontig:GCA_000347335.1:Scaffold3394:24089:27629:1 gene:F775_42665 transcript:EMT31970 description:"Uncharacterized protein "
Sequence
MGPCGGGGGHDRDMDMRGVNRVVKLVVRHGDTVDAISVLYERNGREEWTDLWGGQGGTLS
EICLRPDEHFTGVVGHYGEFDGSFAVRSLTFVSNARSFGPLSTSGKKSSSESDFNLL
Download sequence
Identical sequences M8C3U1
EMT31970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]