SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT32039 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT32039
Domain Number 1 Region: 295-388
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.79e-16
Family B3 DNA binding domain 0.0064
Further Details:      
 
Domain Number 2 Region: 710-811
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000116
Family B3 DNA binding domain 0.0051
Further Details:      
 
Domain Number 3 Region: 490-600
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000188
Family B3 DNA binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT32039
Sequence length 811
Comment pep:novel supercontig:GCA_000347335.1:Scaffold3274:8320:15342:1 gene:F775_03280 transcript:EMT32039 description:"B3 domain-containing protein "
Sequence
MARSGSESYVSRSVNWDLIPVGLEEEMMAIEENANEENARQQLDLIRCQSIASAQMVCGS
DPRQVVAASTEEVRSVWHLSVVADVRPFRWHASDKAICGTSAERMASETSLLQILVFGER
LLRDCSPWFNYFIYVDYFCVTFVFTMSTESDRAAAEKAAADKRIADEADASAAVNCLISQ
QLPQFAMGAYELAWRYSASPAISFQSGIYGMNSVSIFPRRSFLSISKTTGSAFPCRFFYS
AATSSTGASRRGRVAALPRTRAEEDDRGGDAGHFGELNISKMSNPCECCRIKLKFLRQIN
GNFMHSLVIPEWFVNQFGGKIWGTVRLETSDGNMYDVGVTESMNRTILKSGWATFVDANQ
IEENYSLMFRYLGNARFEVTIFDSNGKENTWCCSGMRNASGVHKPSSFDVDNSSSRGGTT
QSSASEGSDSDGSQKERSYSSEESSAEYNLSIDNPVESDDVRNYYVLSGKCDLTEAQELK
LHAFVQKIRPEIPMLVVLMKKSNVRHHGDLVIRKDYAHKYLPCKDTNIILQLPRKNKIWE
CKFQIRPSGSTDAGRRNLSLGDFVGDNLVREGDICLFEPMTNTKQKRFTMTVHILDKLSI
DHSPGRTTDIGSNHGRRCTKMGGVKTKPPINGEEYSSQHEECGVSDNSEECSEPPFMLPH
RSCLTPAQENKVLEKIKDIESDSELPFYVAIMGKINVCRGSSHYIHPPILNFGFRYAARY
LGEKFAAGHHGGKCNAINLVLQREGKSRPWPTKLRYTHVMRASSQQMRVIKGWPSFARDN
RLREGDLCLFKLMENEEQLTMMVYIIRREKC
Download sequence
Identical sequences M8CCB3
EMT32039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]