SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT32040 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT32040
Domain Number 1 Region: 44-138
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-18
Family B3 DNA binding domain 0.0062
Further Details:      
 
Domain Number 2 Region: 256-350
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000804
Family B3 DNA binding domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT32040
Sequence length 648
Comment pep:novel supercontig:GCA_000347335.1:Scaffold3274:34767:41257:1 gene:F775_22646 transcript:EMT32040 description:"B3 domain-containing protein "
Sequence
MPGADKTGRERHHVRGQRKTTVEATQDIIKMSNPCECCQIKLKFLRKINGNFMHSLVIPE
WFVNQFGGKIWRTVKLESPNGNVYDVGVTENMNRTILKSGWASFVDANKIEENYSLMFRY
LENARFKVTIFDSSGKQKASCCARMGTAGPDVRNPSTFDVENSSSSCGGTTQSSPSERSD
SDGSQKESLYGYKKSAKKAAISDSSEELSAEDSVSRGNLVDSYGVQVHLNDYVLSGKCDL
TVAQEAKIQALVEKIRSEIPVLVVQMKKTSANFGNLIIRKDYALKYFPCEATNIILQLPR
KNKEWKCRFNPDRHNLYLGYFVRENCVQEGDICLFQPIAKAKERRFTVTVHLLHKESVRR
SPGGTAGMTHTATDRRTGAKTSLTARVKEEPATDGEDMSSLGPKEDGDNSEGAPETPFVL
PDRASITPAQEQKVWEKVEAIESTVPVYVAILNKCNVARKSGMMINMGKQYASRYLEKQY
ITGHHGKKNVISLVLQREGKSRTWDTELRRGTVLGQTRSGDKRRMPSGDTNAGRTSLSLS
PARTEAAARGLWGYCKQLGFVTSIVVLAMLEGHTPLLAMQRVCCEQHGQRCLEVVMSHTA
ASTGVGGNATTVDATTMSSFVGDVEKAGVATPTQKHVAMSGIVASKKC
Download sequence
Identical sequences M8C404
EMT32040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]