SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT32373 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT32373
Domain Number 1 Region: 41-111
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000314
Family B3 DNA binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT32373
Sequence length 139
Comment pep:novel supercontig:GCA_000347335.1:Scaffold2750:132705:134039:1 gene:F775_03290 transcript:EMT32373 description:"Uncharacterized protein "
Sequence
MDEPNSYEEQRRRQVEENERKLEELRLHRLSAAVREAAVKPMPTIPQQFKKSYLPWFDEM
IFLVDEEDGEFPMPYMAQHGAIGSGWNLFAIGHKLADGDCLVFQQVQRTKFKSNNDVMLI
ELLLSETGITNEQKGIIKT
Download sequence
Identical sequences M8CDW6
EMT32373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]