SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT32415 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT32415
Domain Number 1 Region: 237-333
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000194
Family B3 DNA binding domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT32415
Sequence length 356
Comment pep:novel supercontig:GCA_000347335.1:Scaffold2679:19196:21537:-1 gene:F775_23931 transcript:EMT32415 description:"B3 domain-containing protein "
Sequence
MATLGLFCRESIASARMTHGSTTRCVALPHRRRCGRLAFEHGGGRATPLLAHRRGGERTM
GVVRREHGSAYLPCKAVWAWEMAPALAAVDVGETESHSPAPRMVHQFGRCNRVVVDVAGS
SQTNPSSISHPPAPSGLWLMLFFSIPSSSQILAMAEPIPADSSTAVTPPVYRRRNSSEES
RGISNAGGKDHGVASSAGETSQAAISAGPPDKLDPESAKACLEVEKTQPRILPLLGKPYF
ACVVCKSHVQQPFQVVVPRSLAPFLPSKPTSATLTWQGRSWEMRFTGGRHIQRLEAGWRS
FALDNALRLGDGCVFELVGCDGEGIVFRVQVLRAEIPASIRERAGGYTPSSAIVLD
Download sequence
Identical sequences M8C526
EMT32415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]