SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT32507 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT32507
Domain Number 1 Region: 54-184
Classification Level Classification E-value
Superfamily Bromodomain 1.96e-29
Family Bromodomain 0.00067
Further Details:      
 
Domain Number 2 Region: 375-455
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000824
Family B3 DNA binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT32507
Sequence length 486
Comment pep:novel supercontig:GCA_000347335.1:Scaffold2501:26551:30912:1 gene:F775_52724 transcript:EMT32507 description:"Uncharacterized protein "
Sequence
MTPNDDLHLRESISKQKTQIHARIGPYHRRRPPPTSATQPQGSQSDAFKKGTAPPPVALP
GLPKKPMHHLAAADLPRALERCHRLLDKLLQHEDGWVFAKPVDTHSLELRDYLSVIAEPM
DLGTVSRRPELRRYPNLLCFAKDVRRTFSNAMTYNNKGDDVYESAAKLSRIFESGWASIL
AALPSPPPVAVRRARLKDELPRLPGDLQEKAASGARRWMGGLRWISTRPTRRLLTSSSGC
SLSPPSGRQVARGTLVPTGSTVAPGPAARTFCPLGRDETTRSLELPGPGRDAWQHDRTGT
PPPPRCLGNRRLGHKACCRAKAHHCSSSPSPPSCAQLLFSLCFTSPPLLPWLPSGSSPPL
LRGKAVLEEGLPRLCLLDSFARVMEDGEPLGLWLQADGCCNGPFWVAAEFSPAGFMFLAR
GWKPFARSDDLRRGQVLQFRYDGAATLFVKFFRVSGGRMECCAESESGSLWRKWERLQPH
QRKRKR
Download sequence
Identical sequences M8CXS4
EMT32507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]