SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT32514 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT32514
Domain Number 1 Region: 15-282
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-67
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 429-632
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.98e-36
Family WD40-repeat 0.00089
Further Details:      
 
Domain Number 3 Region: 889-1044
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.02e-30
Family WD40-repeat 0.0014
Further Details:      
 
Domain Number 4 Region: 270-391
Classification Level Classification E-value
Superfamily PapD-like 0.000000000089
Family MSP-like 0.023
Further Details:      
 
Domain Number 5 Region: 721-861
Classification Level Classification E-value
Superfamily PapD-like 0.000000000131
Family MSP-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT32514
Sequence length 1075
Comment pep:novel supercontig:GCA_000347335.1:Scaffold2485:21227:29315:-1 gene:F775_24981 transcript:EMT32514 description:"Cysteine-rich receptor-like protein kinase 14 "
Sequence
MELEYLAHDEDAEPIALPFQLLEKITDYFSHELIIGRGGFAVVYKAVLDNGIVAVKKLSN
THMYEEQFQGEVQCLMKVKHKNIVRFLGYCADTQGNISDYKGKMVMADVQQRLLCFEYLP
KGSLDGYITDSPGELNWRKRYDMIKGICEGLHYLHQNNILHLDLTPGNILLDEDMMPKIT
DFGLSRCFEEDQTGVITKNVAGTRGYLAPECYNKEIILTHKFDLYSLGVIMIEILTGKKG
CQVTIENWDQIRVCAKIGMECTEVDPAKRPASGTRELLLVHPSVICFPFEPNKAITCPLQ
LTNNTDKHVAFRLMDNSMESSFLRLPLYDVVPPNTPYTLIVTTQKKEDLPRKYIIDVILQ
SATLILGDDDHINTFRSQPDKFFQETGNDVQVVKQKALYTLTHIATSFSKVHVYIEMHLS
CLDTNRAKQCELTFPGTAVTCIRFIERKQWIVAGTEDGYLHVYSYETRFQKITSLRVGAI
ENLESRAAHTHLAIHPTQPYLLSVYGFKVKLWDWDVGWECIQTFENEELMTILRVAFNPN
DTFATASMDCTVEVWSLDSPEFIYTLVGHSSIVNCLDFFTCDDQEYLVTGSHDQTAKIWD
LQKMMCIHTLEAFVSPVMSLLYQPDLQILITVIHGFQLYLLTNKIPIGIIHVPRRLIESS
RLLIGKENAVAIIDVDDVNYQEQPTDKSEQQLSACTTHHAGDMSKCYNQEATNPQYKVEP
KEKAWSKSKLLDVHPLELRFPYCPNEPIPCSLHLTNNTDENVAFRLVDKSGKSPWCFTKL
PLCGIVPHGSTYTLTVTMKEEMKLKEETDFDLVIQSSLLGDKYIEVFNDQSESDTFFKEA
KLFGNMVHEVTLKAVYVQYGEITSEFLINSFKVSDQDAGLVLLNWDLSWKTTRIFESEAV
TAETVVFNTRDTNSFASGSYDGEVQVWRLDSSDPEYSLIGHLKKVTCLDFVTCGDQQYLI
SGSYDSTVKIWDLQKRECICTLEAMSPVHCVLAHPNLPVIITGTEHGIIHLWNSTDFRLK
RTISLGGGGPVITLGCLMGSPRVVIGQENAFFAMDIHDDWGGQPQGRDNFIGKFQ
Download sequence
Identical sequences M8CDM9
EMT32514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]