SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT32630 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT32630
Domain Number 1 Region: 52-196
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.49e-48
Family B3 DNA binding domain 0.0046
Further Details:      
 
Domain Number 2 Region: 716-802
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000294
Family PB1 domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT32630
Sequence length 858
Comment pep:novel supercontig:GCA_000347335.1:Scaffold2338:96151:100177:-1 gene:F775_09991 transcript:EMT32630 description:"Auxin response factor 6 "
Sequence
MESQIPNYPNLPAQLICQLHNVTMHADAETDEVYAQMTLQPLSPQELKDPFLPAELGNAS
KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPAQELMAKDLHGNEWKFR
HIFRGQPKRHLLTTGWSVFISAKRLVAGDSVLFIWNDNNQLLLGIRRANRSQTVMPSSVL
SSDSMHIGLLAAAAHAASTNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRISVGMRFRM
LFETEESSVRRYMGTITGISDLDPARWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLT
TYPMYSSPFPMRLKRPWPTGLPSLYGGKEDDLTSSLMWLRDGANPGFQSFNFGGLGMSPW
MQPRMDSSLLGLQPDMYQAMSAAAFQNTTKQVSPTLLQFQQPQNIAGRSALLSSQILQQV
QPQFQEMHHQNINDSAIQGHNQSEYLQQQLQRCQSFNGQKSPPPQQQESHHQHQQQQSQC
MQTPQHQQMQEQKHSPDFQCVPNGLLVFSQLSSTNQSPPSTLQTVSAFSQQQNLQDRNIS
SLAPSNVPSMHDTLRPFPSEAGSNLQGVPRTTPVPVSDPWSSKRVAMESVIPSSSHVNSS
HMQQLDSEPSNIPQSSSLAPLPGRECLVDQDGNSDNQNHLLFGVNIDSQSLLMQGGIPSL
QEDNGCIASLQDDNDSSTIPYSTCNFLSPSQNDFPLNEALASSGCLDESGYASFSENSDH
VNQPTAAFVKVYKSGAFGRLLDITKFSNYHELRSEVGRLFGLEGQLEDPARSGWQLVFVD
REDDILLVGDDPWQEFVNSVSCIKILTPQEVQQMGKQGIDLLSSAPARRLGNSCDNYAGR
QESRSLSTVIASVGSVEF
Download sequence
Identical sequences M8C5M0
EMT32630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]