SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT33466 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT33466
Domain Number 1 Region: 41-375
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.87e-65
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Domain Number 2 Region: 396-495
Classification Level Classification E-value
Superfamily PapD-like 0.000000000000149
Family MSP-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT33466
Sequence length 500
Comment pep:novel supercontig:GCA_000347335.1:Scaffold888:200349:203812:1 gene:F775_11793 transcript:EMT33466 description:"Cysteine-rich receptor-like protein kinase 4 "
Sequence
MLQVMHRWSRRRRPVQKRGKRTSPFRHRASPLVLQIYEHIVFILEEEVTGIELNLLEKVT
NQFSEELKIGSGGFGEVYRGVLNGCEIAVKKLYLTNRSIDDKSFTNEFRQLMKVQHENII
RLIGYCYEIRHKHTKDNGQLVFSQVIDRALCFEYMPEGSLAKHISGIDVGLPLIQLYYLS
SEYHNIFLWADESCKHDWSTTFKIIKGTCEGLHYLHRGTGDGKHIYHLDLKPDNILLDKD
MVPKIADFGLSRLFGESKTHITNTRMEGTLGFMAPEYIHECAISPKNDVFSLGVIIFYLL
AGQKGYNDYCESRSSPGQQFIDRVQEYWKKRMRASVGYTWDKIDLLAVKICTEIAMSCVE
KERRDRPSTNKIIDELHQLDAQMQMSKKDSESVTGLLTNMTENSIAFNVKTNKRKYSPQP
SKGIIPPCSKSYIIVTLRAQEEAPPNMQCLDTLIVQSTRVSEDFTSQEITQHFLEEAEVD
EVILPIAYVAFEKSDLDVSK
Download sequence
Identical sequences N1R509
EMT33466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]