SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT33622 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT33622
Domain Number 1 Region: 1-187
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.13e-65
Family Papain-like 0.00000143
Further Details:      
 
Domain Number 2 Region: 509-652
Classification Level Classification E-value
Superfamily Mannose-binding lectins 7.2e-39
Family Mannose-binding lectins 0.0000338
Further Details:      
 
Domain Number 3 Region: 700-837
Classification Level Classification E-value
Superfamily Mannose-binding lectins 5.63e-38
Family Mannose-binding lectins 0.0000365
Further Details:      
 
Domain Number 4 Region: 315-446
Classification Level Classification E-value
Superfamily Mannose-binding lectins 2.49e-37
Family Mannose-binding lectins 0.0000374
Further Details:      
 
Domain Number 5 Region: 197-231
Classification Level Classification E-value
Superfamily Granulin repeat 0.000000263
Family Granulin repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT33622
Sequence length 857
Comment pep:novel supercontig:GCA_000347335.1:Scaffold487:6202:11894:1 gene:F775_12392 transcript:EMT33622 description:"Cysteine proteinase RD21a "
Sequence
MEGINKITTGSLLSLSEQELIDCDRSYNAGCGGGLMTYAYKFVIKNGGIDTEDDYPFREA
DGTCNKNKLKKHVVTIDGYKEVPPSKEDLLLQAVAQQPISVGICGSARAFQLYSQGIFDG
PCPTSLDHAVLIVGYGSENGKDYWIVKNSWGERWGMKGYMHMHRNTGSSSGICGINMMAS
FPTKTSPNPPPSPGPGPTKCSAFTSCPEGSTCCCSWRALGFCLSWSCCELDNAVCCSDNR
SCCPHDYPICDTARGRCLKGNGNFSSIEGIKRKQAFSKVPSWNVAAFRLAFLLRRSYKLA
RSVFLRVSSANGKSPIVVGPWGGTGGYPWDDGVYSTVCQIMITHGAAVDSIRIQYDLKGH
SVWSQTHGSTEDGSETDKVKLDVPGEILLSVSGYYGSVCGSPVIIRSLTFQSNRSKYGPF
GTEDGTPFSLPVSSGKIIGFHGRRNGYTVTEVDDEHDMALAVRDRADGYAVYGAGYPKQQ
YAHPSPDYHDGSIMNKMVSYPSSYRAAAMSGPETHGPWGGSGGTIFDDGVYTGVWQINLT
RAVGVTSMKVLYDRHGQAVWGNKHGFSSGVPPDKIAFDFPSEVLTHITGYYGPTIIMGPT
AVRSLTFHTNRRRYGPYGDEYGTYFSTSFADGRVVGFHGREGWYIDGIGVHVQQGKVPRS
LRAAASRSPSPAPRSDPDPSDVDEEVPYAAMVKEPAAAGPGPWGGPGGRAWDDGVYAGVN
QVYVTRGALIGSIQIQYDRGDRSEWSARHGTSGHITHRVKLDAPHEVLTCVRGYYNADPA
EGPRALRSITFVSNRGRYGPFGDEVGTYFSSPATAEGKVVGFHGRSGQHLDAIGVHMQHW
QGDRRAAPKYVLSKYLC
Download sequence
Identical sequences N1R5F0
EMT33622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]