SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT33733 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT33733
Domain Number 1 Region: 440-693
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.3e-37
Family WD40-repeat 0.0023
Further Details:      
 
Weak hits

Sequence:  EMT33733
Domain Number - Region: 284-384
Classification Level Classification E-value
Superfamily PapD-like 0.0183
Family MSP-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT33733
Sequence length 708
Comment pep:novel supercontig:GCA_000347335.1:Scaffold265:161593:166038:-1 gene:F775_23576 transcript:EMT33733 description:"Uncharacterized protein "
Sequence
MADPFSLIMEILDIGFKIKSALDNAKHNMEECPKIDALLLSLSAIAKHLQGSPKIMEHHL
MRDTAKSLDKTLQLASELVAKCKAKGFLDRVLNAKHVAEKLRGVCHDVQLNMNAVLLANG
VLNSSELAELKEIVAKILHIVATQPAVHLQEEVEKLVEDDQISSQIKNKGKAKKTAAATS
QDKNKGEADKTVVARPEDKIEKKKKKLRRSTVVPHASLQDDLAESTSATSMVGQDDGPST
IIINKASSSISKLEDEAQSVGVSAAPLFHPQKIISISRETGGYKIQPPSPETSKLLEVYP
QRLLFPLEPKNKETTGSGCPVTLTNNTDNYVGIWIKPINEKFKETKIMEPHSTFVVYATM
KMHAQPPKDTVEFEVLMIIVESKGDHGKLESSISGKLKMDSGFMVNVKNLKAEVYHAMLT
AITCEPASCQIISRSIENMTLVTSIDAHPTKPWIVTGHEGGNFSIWDYQKQETVMKLQVN
KVPDKTTLMFHALSQRIKVRPPKHSLFSVKFIAERKWLVVGDGDGYIYVYDYTNTELHMV
KKFEAHDKKSVNSLAAHPTEPYLLSSSTIGTNIKVWDRSNKWKIFRNFNTKPEIAYYNGV
RSVKLNPRDTNTFACVTRYDGVKIWDLKTQKVVHTLSVSGHKTTWVACHPKLPILVTMLD
DGTVCLWDASTYRLEKMVHITDSKCCDLVFVPHTNGPLRISRRLLRDL
Download sequence
Identical sequences N1R4M9
EMT33733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]