SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT33809 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT33809
Domain Number 1 Region: 12-158
Classification Level Classification E-value
Superfamily Mannose-binding lectins 1.31e-37
Family Mannose-binding lectins 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT33809
Sequence length 177
Comment pep:novel supercontig:GCA_000347335.1:Scaffold115:201519:202698:1 gene:F775_16156 transcript:EMT33809 description:"Uncharacterized protein "
Sequence
MPTTIKVVIYRTFVTYGPWGGNGGTAHDIRAASSLRLKSVTIPYGDIIDSLTFSYSDHSG
HVHRVGPWGGTGGANKYTINLDPTDFVKEISGKFGPYPLSRSNVITSLKLVTHEDTYGPF
GFVEGTPFCATLESGWAIVGFFARAERYVHKIGVYARPLTLDAQEPAVNSELERGQE
Download sequence
Identical sequences N1R4X8
EMT33809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]