SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT01567 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT01567
Domain Number 1 Region: 82-221
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.62e-43
Family B3 DNA binding domain 0.0052
Further Details:      
 
Domain Number 2 Region: 982-1034
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000863
Family PB1 domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT01567
Sequence length 1052
Comment pep:novel supercontig:GCA_000347335.1:Scaffold149683:6023:11923:-1 gene:F775_12532 transcript:EMT01567 description:"Auxin response factor 16 "
Sequence
MPPVGSLVVYFPQGHSEQVAASMHKEVDIIPNYPSLPSKLICKLLSLTLHADSETDEVYA
QMTLQPVNKYDRDAMLASELGLKQNKQPVEFFCKTLTASDTSTHGGFSVPRRAAEKIFPP
LDFTMQPPAQELMAKDLHDIPWKFRHIFRGQPKRHLLTTGWSVFVSTKRLLAGDSVLFIR
DEKSQLLLGIRRATRPQPALSSSVLSSDSMHIGILAAAAHAAANSSPFTIFYNPRASPSE
FVIPLAKYNKALYTQVSLGMRFRMLFETEDSGVRRYMGTITGIGDLDPVRWKNSHWRNLQ
VGWDESTASERRTRVSIWEIEPVATPFYICPPPFFRPKLPKQPGLPGDTNVGWDESTASE
RRTRVSIWEIEPVATPFYICPPPFFRPKLPKQPGMPDDESEVDSAFKRAMPWLGDDFALK
DVQSQLFPGLSLVQWMAMQQNPQMLPAGAPAVQAPYLNSSAMAMQDGMGTGNDDLMRRFN
MQGQNIGLPNSQQVGSKMDHPAMAQHQQQSHQLQQQQQVQQSQQSSVVQQQQAQLLQQNV
IHLQQQQEHLQRQQSLPQQQQEHLQRQQSQPQQQLKTAASMPSMEQHKLREQQPQGGQAV
SQAQMLSQIFQPSSSQLQQLGLPKSPTQRPGFPGLPTASSLQQPALGQAPQVQQAAEYQQ
ALLQSQQQQLQQLSQPEMQLQLLQKIQQQNMLSQLNPQHQSQLMQQLSQKNQEYLQQQIL
QHQLSGSDAMVQFKQSHQTPSNNITGSLTPQQLVRSHSALAESEDPSSSTAPSASRLSPM
NSLSRTHQGSRNLTDMTTSPHIDNLLQEIQSKPDNRNKNDMQSSKEAIPVPNRYPVSDQL
DASSATSFCLDESPREGFSFPPVCLDSNAQVDPRDNFLIAENVDSLMPDALLSRGMGSGK
DICNLPSGQRDHREVDNELSSAAFSSQSFGVPDISFKPGCSGDIAVNDGGMPSQGLWNNQ
TQRMRTFTKVQKRGSVGRSIDITRYTNYDELRHDLACMFGIQGQLEDPYRMDWKLVYVDH
ENDILLVGDDPWECSANRLIAELLRLVPTKIR
Download sequence
Identical sequences N1QRI9
EMT01567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]