SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT01811 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT01811
Domain Number 1 Region: 503-610
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000011
Family B3 DNA binding domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT01811
Sequence length 640
Comment pep:novel supercontig:GCA_000347335.1:Scaffold141249:13560:17008:-1 gene:F775_01649 transcript:EMT01811 description:"B3 domain-containing protein "
Sequence
MRRSKGSGRRRAADERKLIRMADEAAAASSMQAAAAAALASLHLPPPGLTETDNQDRKIF
GRGARIKRKAKRKWGYVGAEAGAVDSGGLRPRLLSHRRSTCRGGVGSMDEVLHGEVGIRS
RFSAGRIREIMRGLTPRQQGYVAKYGFEHFNRIGAFSVHEPLTEWIMGKINPPFSEFRIN
ADKTIVFSKPLVQKILGVPTGGRPFVLHGQKSDKIKELRDLYLNNGLRATIPHCVSLLKN
NEDEESFMRTFLLLAAVLTPTTGNTIDLDYLWAFEDMSKVQDLDWAGHITEHLMDEVQKF
QYKSREEKMRDFWVGGCLPLLTIAYMDHLDLPRGRIVDHEINYSVPRICHVSKDDFQFAA
IADLHRQHFKFATFGILPFRDRTPYTDNPVTDTEVAEDDLRILSNDQVLSGQWELVEVHE
QKIDELVKETQPEALGFAEASIDHFRLGRTDISSNQVEDSGREYESSESDDHPTPPEADY
GVIFRSYLSGTQMESVNTLIHKIKPETIVFVATMRKSDVQLPTPLLIISKERSLAAAARF
PHENGAVTLQMPGKSEKWRPRFFIEKDNCMLAGNWLDFVCDNQVQAGDICIFVPAMGGER
STFTVHIIRAEATHQRGVKRVRSSHDSPVGVEGMTNPDAV
Download sequence
Identical sequences N1QSY8
EMT01811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]