SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT01999 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT01999
Domain Number 1 Region: 5-103
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000157
Family B3 DNA binding domain 0.005
Further Details:      
 
Domain Number 2 Region: 417-533
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000216
Family B3 DNA binding domain 0.006
Further Details:      
 
Domain Number 3 Region: 232-339
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000196
Family B3 DNA binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT01999
Sequence length 534
Comment pep:novel supercontig:GCA_000347335.1:Scaffold136382:2838:6107:1 gene:F775_22920 transcript:EMT01999 description:"B3 domain-containing protein "
Sequence
MAFEFFTILLSNSLKKLRLPGKFARVFDGHEPFEVKLREAGRRHHLWDVEVVFDAEGHIY
LGRGWEQFAGAHDLRLGHFLVLSYGGCHAHAMLTVKVFDGSMCRRDYQNDNDASSGSSGD
SGNTLFLTMYMVRLLGQQGAEGEGEVPPQTEAEEGDGEQGVSKMSNPCDSDGSQKGRSYS
SEKLSAEDSLFVDNSVASANLQTLSCNYVLSTQCYLTKAQKVKIDALMEKIQPKFTVLVV
QMKKSNVKQHATLIIHKDYALKHFPCEDTTVILQLPGKNKDWKCTFRIRPSGTSDAGRRN
LFLYNFAYDNHIREGDICLFQPITNVKQRTFIVTVHVLHKVSIDHYAGGRTDIGSNHGRK
RAKMGAVKDKPRTDGEEHKISEDSEGASEGLFMLSNGVCLTPAQRMKLLKIVKKIKFKPP
FYVAIMSKSTVCQRGSQNNPMLRFGSQYATRYLVEKFAGGHPCGKHRGVELVLLREGKSR
SWPTKLRHSLRGSRVLKGWPSFARDNQLREGDLCLFKLLKSEELLTMMVYIVRR
Download sequence
Identical sequences N1QU52
EMT01999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]