SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT02182 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT02182
Domain Number 1 Region: 409-493
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.1e-16
Family B3 DNA binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT02182
Sequence length 945
Comment pep:novel supercontig:GCA_000347335.1:Scaffold131179:19554:29503:1 gene:F775_30051 transcript:EMT02182 description:"B3 domain-containing protein "
Sequence
MQHIKQRWMAPFNPPSCGVRLATVVRTVVSMFYFVLPMGMDEKWRKSVWWRIAWWEAGSG
SFEHGTFCETFHSEVAGWRKCEACGKRLHCGCIVSVHAYALLDAGGVDCILCARKSYAAM
APSQMWSTPTVHMPQNVADRKDSYVKSWRPPTGQISSQWRQNHQLWNMSTIQADLQQRLA
YEFDRPSGSEKLPPGRTFIHAQEKKSDDMHDRPTTPAGMGQIIRDRYANGLGQQTSMDPT
HSSTPYQREGPNPNSLHDPSHHVGESDPLSSRKGIISDGGSTVSTGFKLDSHHPSILKDD
AASTLPTMGGYTITNYPPVPGRSDHLRIIPNNPQQPPTTVPLSVVQKQFYSHSVIEPNYQ
AQFRNGKPRMDPKARSELLPRYWPRITDKELQHLSGEYPKNSTSNSVITPLFEKMLSASD
AGRIGRLVLPKKCAEAYFPPISQPEGLPLKVQDASGKEWVFQFRFWPNNNSRMYVLEGVT
PCIQSMHLQAGDTGSKQGLTGRRATMLVKTTTVNDNHFGMLVKVSFSRIDPEGKLVMGFR
KTKTQEQIFRQEEPTKPANAAPNLPDVNINVTAPDSSPNSSLVRPNKVNTENKDSSPVEQ
AASKIDKGGVAQKEGPGTVRTSPGPVKRKATSIGPKIKRFRIDNEESMELKITWEEAQEL
LRPPLKAPSVVIVDGHEFEEYEEPPVLGRKTYFVTDQSGENHQWAQCEDCSKWRKLPIDA
LLPSKWTCSDNKWDPERMTCVSPQEASMEELAELIPIKAGAAKKAKLRMDTDSIDVSDGL
DTLANLAILGEGESLPSQPTTKHPRHRPGCSCIVCIQPPSGKGPKHKQTCTCNVCMTVRR
RFRTLMLRREKRASEKESEEPPRKKEQGQSSESPQDPLLASTSPTSTPQKVNGNGDDAEE
AVEHSMASSPMKNQIDLNIQPEREDEQSPKSDAVGAMRLPRENAA
Download sequence
Identical sequences N1QS08
EMT02182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]