SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT02606 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT02606
Domain Number 1 Region: 307-391
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.9e-19
Family Ankyrin repeat 0.001
Further Details:      
 
Domain Number 2 Region: 8-55,90-123,192-219
Classification Level Classification E-value
Superfamily POZ domain 9.94e-18
Family BTB/POZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT02606
Sequence length 505
Comment pep:novel supercontig:GCA_000347335.1:Scaffold120763:13506:16963:-1 gene:F775_21884 transcript:EMT02606 description:""
Sequence
MSSEDSLKSLSLDYLNLLINGQAFSDVAFSVEGRLVHAHRCVLAARSLFFRKLFCGLDPS
HQPPPPPLNWPNAGGGSGGGGGGGSRGGSGGAPATPELVIPVSSIRYEVLVLVLQFLYSG
QASVAAPKSGPLPGCGARGCWHTRCGAAVDLALDTLAAARSFGVEQLALLVQIIIWENLS
MQKQLESMVKEASVDDVMKVLMASRKFEMQELWATCSHLVARSGLSADLLAKHLPIDVVA
KIEEIRAKSPLAGGGASQPRSPFLTHHYLPINNGPSSAADRDHKIRRMRRALDAADIELV
KLMVMGEGLDLDDALAVHYAVQHCNRDVVKALLELGAADVNSRAGPTGKTPLHLAAEMVS
PDMVSVLLDHHADPNARTLDGVTPLDVLRGLTSEFLFKGAVPGLTHIEPNKLRLCLELVQ
SAVMVTTRDDGGGGDGGGAGGSDGGNFGRGDADDSLVVHRLGFGSGVSGVFPQSDLFNGN
GFVFGEPLWKSAKLHIRDGVASSSR
Download sequence
Identical sequences R7W5D2
EMT02606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]