SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT03524 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT03524
Domain Number 1 Region: 44-515
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 4.58e-90
Family Acetyl-CoA synthetase-like 0.00000742
Further Details:      
 
Domain Number 2 Region: 742-1106
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.73e-36
Family Quinoprotein alcohol dehydrogenase-like 0.0088
Further Details:      
 
Domain Number 3 Region: 535-597
Classification Level Classification E-value
Superfamily ACP-like 0.00000408
Family Peptidyl carrier domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT03524
Sequence length 1110
Comment pep:novel supercontig:GCA_000347335.1:Scaffold106958:11378:20182:1 gene:F775_01430 transcript:EMT03524 description:""
Sequence
MKVAAGDLEAPHSVEGLSIWGGGPGRRASGCLDRHGGGADATPRVVGVYASPSVEYVVAV
LAVLRCAEAFLPLDPSWPEDRVRSAVSASNAALVVSAGVSHEDDVLKGSSCPVLQFNGDI
RCRQGSDDVEAGVGGDELVWPCERERLRDFCYVMFTSGSTGRPKGVCGMEKGLLNRFLWM
QRRNPLCSDDVLLFKTSVSFVDHLQEFLSAVLTSTTLVIPPIDWRANPTSLANLIKAYRI
SRMTIVPSLMEIILPTLEKNISCVYNSLKILVFSGEILSLVLWKRVREILPETTIINLYG
TTEVSGDCTFFDCKDLPGILEREEITSVPIGFPIANCEVFLVTHAGIADEGEICVSGACL
FNGYLAEFLSSNHTEGSVISTYYKTGDYARRLKAGELVFLGRKDRTVKIYGQRFSLEEVE
STLKEHPAVSDAALTFQSKGSPDYKAYLVFKNKDGIVKDSLQYREVNSSQDIMASIRSWL
IKKVPPAMIPSFFLHVKSLPLTSSGKVDYVKLSSLECASEPCGIAQIKSGSGLVNPYLQV
IKKAFCDALLVDEVSEFDDFFTLGGNSISAAHAAHKLEIDMRLLYIYPTPSKLLDALIVD
HSNLVSPTDEPQPKKGLDVSTSVHGLFDPIAANADDGYHGGKARINGKRAHYQIAGSYGN
ETDGQLNKYPFSPDDRCQVNDLYLDTCLMDRNSVMGSQWILNFCLHKKWSIGRCNRFMHD
DEGKLQLEGVCSYVSYNKRGYLQELWNIPLDSCVDASPLLVLNNGMINIFIGSHSHLFLC
IDGCNGSVRWSVKLEGRVECSAAITGDFSEVVVGCYKGKIYFHDMLTGKLSWTVQTDGEV
KMQPVVDRTRSLIWCGSYDHHLYALNYKDRCCAYKVSCGGSIYGSPAVDMAHDRIYVACT
SGLVTAISLEVPSFRIVWQYEAGAAIFSSLAIDHQSGNVVCCLVNGLVIALNSHGTVVWK
SITNFFKTQATVGGPIFAGACVSSALPSQVLISSRDGSLYSFDITSGDLLWSYDVGDPIT
ASAFVDEVLASTPSGSPERFACICTSSGKVRVLGIRADAEQEKVGYSVQEFAAMDLPGDI
FSSPLMVGGHIFVGCRDDRLHCLSITNPFN
Download sequence
Identical sequences R7W0W2
EMT03524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]