SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT04282 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT04282
Domain Number 1 Region: 237-379
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.31e-47
Family B3 DNA binding domain 0.0054
Further Details:      
 
Domain Number 2 Region: 875-952
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000334
Family PB1 domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT04282
Sequence length 1011
Comment pep:novel supercontig:GCA_000347335.1:Scaffold97741:5309:10872:1 gene:F775_09040 transcript:EMT04282 description:"Auxin response factor 25 "
Sequence
MAIRGGEWSRFSGPLQAEAAAASWRRGNSRLDEAAAEDGGAVLGAEGEVGRCCREPGVAL
SSQLLRVPAASRRSSVFSASVASLDGEKALHVRDAAVPPGKRWYISSHGPLINSAVQFST
CTSVCISSGLRIVECADWEQRCLNSELWHACAGPLVSLPAVGSRVIYFPQGHSEQVAAST
NKEVDSQIPNYPNLPPQLICQLHNVTMHADAETDEVYAQMTLQPLSPEEQKEPFLPIELG
AASKQPTNYFCKTLTASDTSTHGGFSVPRRSAEKVFPPLDFSLQPPCQELIAKDLHDNEW
KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVIFIWNDNNQLLLGIRHANRPQTIMPS
SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFIIPLAKYVKSVYHTRVSVGMR
FRMLFETEESSVRRYMGTITTISDLDSVRWPNSHWRSVKVGWDESTAGEKQPRVSLWEIE
PLTTFPMYPTAFPLRLKRPWASGLPSMHDMFNGVKNDDFSRYSSLMWLGDGDRGAQSLNF
QGVGASPWLQPKMDSPLLGLKPDTYQQMAAAALEEIRTGDPSKQSSALLQFQQTQNPNGG
LNSVYANHVLQQMQYQAQQSSLQTVQHGHSQYSGNPGFLQSQFQQLHLHNPPAPSQQGHQ
VIQQSHQEMQQQLSSGCHRISDVDSSMPGSESASQSQSSFYQQNLLEGNNDPSLHLHNGF
RNFSSQDSSNLVSLPRTDQLMAPEGWPSKRLAVEPLGHIESRSVQPKHENVNHQSNMSHF
AGTLAPQSARDSSSVQAYGANVDNQFLSSSFAFQDGMAGARGGSSSGTVSMAIPLLRYSG
EDLPPADTLATSSCIGESGTFNSLDNMCGVNPSQDGTFVKVYKSGSPGRSLDITKFSSYY
ELRGELEHLFGLEGQLEDPVRSGWQLVFVDRENDILLVGDDPWQEFVNSVGCIKILSQQE
VQQMVRGGGEGLLSSAPGARMAQGNVCDGYSGGHDLQNLTGNMASVPPLDY
Download sequence
Identical sequences M8BMR2
EMT04282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]