SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT04668 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EMT04668
Domain Number - Region: 7-43
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00196
Family B3 DNA binding domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT04668
Sequence length 51
Comment pep:novel supercontig:GCA_000347335.1:Scaffold94225:39943:40098:1 gene:F775_04433 transcript:EMT04668 description:"Uncharacterized protein "
Sequence
MARFIKGVDNRATLTKNWSNFFHKANMKKGCAYAFVFKCMSKGLCMTVYSI
Download sequence
Identical sequences M8BD27
EMT04668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]