SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT05389 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT05389
Domain Number 1 Region: 233-338
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000255
Family B3 DNA binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT05389
Sequence length 348
Comment pep:novel supercontig:GCA_000347335.1:Scaffold88354:14746:16227:-1 gene:F775_17914 transcript:EMT05389 description:"B3 domain-containing protein "
Sequence
MAAGDVATVFLEMSLGTRLAVSFPAPSTTVADLKRRVSHEHAACFPHLGQIAVQSIKIEH
GGSWFHLADSMAVRDAFLFQGINERWHLQVDASPQVDQGMVTQQGHSGGADSANHSAPAP
GRGHGCGGSSSRRCGKASSSDEMLPDQAEVEVEAEREQPLTGKGEGSSNGAEQDREQGAW
GRRLRPRTQAGKTPITLSSGSSSESEEMDTNTVGGGSSSSSESEEMDNNTVDAPAPQFVV
ELKKCHFVKQNGQYLNVPMEFGVVHRYTEKKKVLLRMGGESWAVNLKHGLTPTGRPRTSL
RYGWQQFRVDNRLRVGETCFFRALPGDDDGDHHVLKVEVRRLDGSYAT
Download sequence
Identical sequences A0A1D5ZPJ6 M8AVE7
EMT05389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]