SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT05572 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT05572
Domain Number 1 Region: 220-607
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.7e-92
Family Regulator of chromosome condensation RCC1 0.00062
Further Details:      
 
Domain Number 2 Region: 7-117
Classification Level Classification E-value
Superfamily PH domain-like 1.98e-22
Family Pleckstrin-homology domain (PH domain) 0.0035
Further Details:      
 
Domain Number 3 Region: 606-679
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 8.15e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0015
Further Details:      
 
Weak hits

Sequence:  EMT05572
Domain Number - Region: 789-864
Classification Level Classification E-value
Superfamily t-snare proteins 0.0526
Family t-snare proteins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT05572
Sequence length 1070
Comment pep:novel supercontig:GCA_000347335.1:Scaffold86856:6720:12108:1 gene:F775_20044 transcript:EMT05572 description:"Putative E3 ubiquitin-protein ligase HERC2 "
Sequence
MADPGVDIDKALIALKKGTQLLKYGRKGKPKFTPFRLSTDESTLIWVSSNQEKSLKLASV
SRVLSGQRTLVFQRFLLPEKDHLSFSLIYKDGKRSLDLICKDKVETQVWFTCLSALVSPG
KHRSQPQHTDEMRSSALSFDCGRESSLSSSSTFTTDSLENKLSSANSKDRSSGEYAYSER
TDVSDMQVKSVSSSDIRVSVSSALSTSSHGSGGEDSESFGDVYVWGEVMCDTASVSGSDG
NTLSPGATTDILVPKPLESNVMLDVSSVACGVKHAALITRQAEVFTWGEECSGRLGHGAG
TSIFQPRLLESLSTCNVEIMACGEFHTCAVTATGDLYTWGDGTHNAGLLGHGSTVSHWIP
KRVSGPLEGLQVSTVSCGTWHTALITTSGLLYTFGDGTFGALGHGNRETISYPKEVESLK
GLRTISVSCGVWHSAAVVEIIMTQSNASSGKLFTWGDGDKYRLGHGDRASKLKPTCVSSL
IDYNFHKSACGHTLTIGLTTSGHMFTVGSSVYGQLGNPNNDGRYARLVEDKVGGGGVVEV
ACGSYHVAVLTNAGEVYTWGKGANGRLGHGDIADRKVPTLVEALRDRSVKRIACGSSFTA
AICQHKWVSGMEQSQCSACRQPFGFTRKRHNCYHCGLVHCHSCSSKKALRAALSPNPGKP
YRVCDSCHMKLSKVMDSGLSYNRNNIPRVPGDTKAERMDTKANRVASSTSSDMIKSLDVK
AAKQAKRSDHSPQFPAILQMNDVPFIGSGDLHTTGFTVTNGYPNDPRYTSQFLRMPYLSS
PSSVSSESLESFRDANELLKQEVQKLKEEVNSLRQQRELQDAELKKSEAKASEAAALAAE
EASKSKAAKEVIKSLTAQVKEMAERLPAGDSDVKPPRVPYLPAGGVVSPEMGREGQKRYE
PVSIHYSQTPTSVTSSWSNGLPPQAHQIGKPGDNTVAPHENMFENFNKSRDFPATHQRTN
SAMSGYRPRSEDFDRREAERFQINLQDWNTRGSGSPSNQVESEWIEQFEPGVYLTLVTLH
DGTKELKRVRFSRRRFAEHQAESWWSDNHEKVYDKYNLRRTDRISSVLTS
Download sequence
Identical sequences M8BRI2
EMT05572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]