SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT06404 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT06404
Domain Number 1 Region: 230-326
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-19
Family B3 DNA binding domain 0.0022
Further Details:      
 
Domain Number 2 Region: 82-178
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-19
Family B3 DNA binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT06404
Sequence length 463
Comment pep:novel supercontig:GCA_000347335.1:Scaffold80945:11895:15243:1 gene:F775_03395 transcript:EMT06404 description:"B3 domain-containing protein "
Sequence
MGEGDGDVVMHAGGQRDGHGGPAVSALHALSMGHHLEPSVGSGEAPWAMGKTIGGGVRGA
AKRMGMSFGSCKLPDEQYYKHLDDEKKHFLVLMLGDFEDSMIIPEEVVRRLKGEIPGEIK
LETRNGYSHTIVVAKNQEKLVLTVGWRQFIENYDLQIGDSLMFRYKGTSQFNVMIFDKLG
REKALSVVLDPFLHRVQDRRNEAHEIGSSKKMDVPWERCKSRTEYHYANLDDEKKYFLVH
MMGVFQHEMIIPEEFLQRFKGEFPREMILETQNCRSYVIGVAKNNGNLVLTVGWGKFVGT
FGLEMGDTIVFRYIGNSRFNVIIFDELGCEKTIETQPFSIGKGMRMESPRLQMEMDKSWE
DNNTVLSVSSHESSGDPVYYEEECGVREVPGSDFKVRKKKARLSSNQKEQLKDGYFISHK
TKLTSTQKEMVKQMVQSIYSEIPIFVAVMSKCNVVVEFYLVPE
Download sequence
Identical sequences M8AYD2
EMT06404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]