SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT08426 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT08426
Domain Number 1 Region: 11-59
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000523
Family F-box domain 0.005
Further Details:      
 
Domain Number 2 Region: 85-188
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000451
Family B3 DNA binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT08426
Sequence length 207
Comment pep:novel supercontig:GCA_000347335.1:Scaffold69090:38952:39575:1 gene:F775_52702 transcript:EMT08426 description:"Uncharacterized protein "
Sequence
MDLSAKIKRTELPEDLVLEVLTRVANAAALVRCATACKRWRALAANPSFVRRRHQVLMGR
ALVADPIRRRHQVLMAVVSVYDGEWALCKVLRHSDVDPTQNRLLLTTWMGQGGPILMLFP
ELEQVGDNGMQNEVVEAVLIDAEWGVEKLATVRYMNANMTYRIIGRGWREFVRDCRISHG
DRVDIYVGRRDTGERCLLFFNSKGAQG
Download sequence
Identical sequences M8B347
EMT08426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]