SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT08500 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT08500
Domain Number 1 Region: 42-96
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000451
Family B3 DNA binding domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT08500
Sequence length 127
Comment pep:novel supercontig:GCA_000347335.1:Scaffold68735:5525:6523:-1 gene:F775_21142 transcript:EMT08500 description:"Uncharacterized protein "
Sequence
MVKTNLAEFSKVTRRPGLMSQRRPVTQREKEDAMERARRFKSTRPFTVKAMKHNDVYASY
FMIIPDKFMKTFLPKESRKMTPWDTQAKPWKWSLVIILKIAIQVSITCNYIVIHRNNDIR
EKSYYYE
Download sequence
Identical sequences M8B4G2
EMT08500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]