SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT08502 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT08502
Domain Number 1 Region: 197-271
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000353
Family B3 DNA binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT08502
Sequence length 291
Comment pep:novel supercontig:GCA_000347335.1:Scaffold68735:19358:21249:-1 gene:F775_21144 transcript:EMT08502 description:"B3 domain-containing protein "
Sequence
MHMVLPPEEEDAHTNTSAVGTPQNKASEEEEAEEEEDALSESLENEEDSESRMCCDDALE
PTQQQQDYRHKTDDEESEHRPTKKSKFEEIRSPFGDSASKAASLGDNFVEFASRPSKESQ
AEGKSSAAPLIVYTRHKSFGNKYGMEAQFTMFNKSNGENQPGRVLIRVTRRLGLTSQRRP
VTQREKEDAMERARRSNRFMKTFLPKESRTMTLWDPQAKPWKAWYKYTCGECPHAVLSAG
WGTLAMENNLEKWDMCVFELLDQEYNIKLHIHKVFLMITPCVLAPKPRIDE
Download sequence
Identical sequences M8AVK3
EMT08502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]