SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT08528 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT08528
Domain Number 1 Region: 198-292
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000051
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT08528
Sequence length 301
Comment pep:novel supercontig:GCA_000347335.1:Scaffold68630:6531:10336:-1 gene:F775_24446 transcript:EMT08528 description:"Uncharacterized protein "
Sequence
MEVRSPGRKSRTWDAWGSRRQRLLCPTLPRRSSKPARSRLILTRVVKPMDKRLFDGERIY
ARGDYLKCARILYIFHQALFLDAMLEDTVAPKIYGCVKQEEVDTANDTSGGQITHDEPLC
RKHNKRYEYIHRPRKASSIQKFKGKKIHLKPGKYILRGEPCKHYLDEFSRHVVWGNIVRL
YNHNGRAVRKIIRSTTTPNNYYVCHMTETFATQGKRMYFNVHFSMGSLFPHMDAGHGELP
ITTGDGTTTVTARFIKGVDKRATITKGWSDFFRRTHMNEGQAYAFGFKCTSKGLHLIVYS
I
Download sequence
Identical sequences M8C007
EMT08528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]