SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT08925 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT08925
Domain Number 1 Region: 550-651
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.02e-22
Family B3 DNA binding domain 0.0021
Further Details:      
 
Domain Number 2 Region: 28-127
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.59e-19
Family B3 DNA binding domain 0.0029
Further Details:      
 
Domain Number 3 Region: 396-500
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-19
Family B3 DNA binding domain 0.0051
Further Details:      
 
Domain Number 4 Region: 785-877
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.16e-18
Family B3 DNA binding domain 0.0041
Further Details:      
 
Domain Number 5 Region: 236-345
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000353
Family B3 DNA binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT08925
Sequence length 907
Comment pep:novel supercontig:GCA_000347335.1:Scaffold66717:21661:27376:-1 gene:F775_02285 transcript:EMT08925 description:"B3 domain-containing protein "
Sequence
MPVQSDQRMDKSCTRCKDYVAHQYWDHMDNRKKRFFKLMLGNFRNGVTIPEKFVRSVGGM
ISELVKLETPDGNTYNVHIAKELNNLVLRSGWSKFASVYELQEGDLLRFKYNGDSHFKVE
IYDPSACEKEIYCVVMNHNPGLQKRSVPHDNQMLSPEGERLAKRQNGCCSDGCKTSEMNP
AGSPHKPTKKEVPSSEDARSSGERKTFTRSHYFLATGCNLTDAHKVEVDKIEQNIRPEIP
LYVKTMSSASLVDGFLIICNRSYLICKDDAIKHLPRKDEFITLCHASHSKTWGAHYNINA
DDTYHLSAGWLRFVDDNQLQKGDTCVFEVLKRQRSFTMAVHLLKASHHQPPGFPTSSNSL
RPEVKSFRPEDKVRLSRFTTLEGLLKTKVYEKVEAIKPEIPVFVSIMMKTNVSSRTPSLA
FSLDYAKYFLPGENQIFRLHRPGESAPWKAEFRSFGSRRWLVKGWEQFVIDNELELDDVC
LFERIENKKKLRMMVHIIRKEDIKILQIFVGGHILIKCTNSGNPTKYEMMGEKGCESCKK
WQEHYYWEHMDVSKTKFFKLMTQDSQQRFRIPDKFASSFIRQTQSSQGFDLEAPSGETWH
VGVTKVANDLFFSSGWGDFVKAHELQENDLLVFTFSGNSSFEVLIFDATGCEKLSSLFAG
AGMHKHFDGMVGQQVEQYSPSDDSDEDDDNDDDDDDDDDDTSVPSQLIESPHKVSTLRKF
SGKTKPSKELRESPNSSSSCDVKHEETEEEESDDDTYADFDYCYSRAAKQLPDDEKSEII
GLASIQPGNPAFMTVLLRAHLQHKNNFLVIPSEFVDEHLHMRSHEVVLLRPNREERWHVR
YYQGSSSRGFRGQPWAKFVRENELREGDVCVFELIKGARNEKKLARTTMAIHVARRRKSN
GRFALVD
Download sequence
Identical sequences M8B5P7
EMT08925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]