SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT11663 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT11663
Domain Number 1 Region: 59-153
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-18
Family B3 DNA binding domain 0.0071
Further Details:      
 
Domain Number 2 Region: 458-570
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000373
Family B3 DNA binding domain 0.011
Further Details:      
 
Domain Number 3 Region: 271-365
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000902
Family B3 DNA binding domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT11663
Sequence length 576
Comment pep:novel supercontig:GCA_000347335.1:Scaffold54420:20725:24901:1 gene:F775_11859 transcript:EMT11663 description:"B3 domain-containing protein "
Sequence
MDALSISKTRPAFPSTLQQPLAPRYKMFYLFSDSDVYRRISNISKMSDPCECCQIKLKFL
RQINGNFVHSLVIPEWFVSQFGGKVWRTVKLESPDGNVYDVGVTENMNRTILKSGWASFV
DANKIEENYSLMFHYLGNARFKVTIFDSSGKQKASCCARMGTAASDVRNPSTFDVDNSSS
SCGGGTQSSPSERSDSDGSQKESSYGYKKSAKKAAISDSSEGLSAEDSLSRDNLVESYDV
QEHLNDYVLSGKCDLTVAQEAKIQALVEKIRSEIPVLVVQMKKTSANFGNLIIRKDYALK
YFPCEATNIILQLPRKNKEWKCRFNPGRRNLYLGYFVHDNCVQEGDICLFQPIAKVKEGR
FTVIVHLLHKESVHRSPGGTAGMTHTPTDGRTGAKTSLTARVKEEPATDGEDMSSLGHKE
DGDNSEGAPETPFILPDRASITPAQEQKVWKKVEAIESTVPVYVAVLNKCNVSRKYGITI
TMGKQYASRYLEKQYFTGHRGKKNVISLVLQREGKSRTWDTELRRGTDRMRICKGWVAFV
RGNRLRVGDLCLFKLMESEEPLKMMVYIIRREKCLD
Download sequence
Identical sequences M8C959
EMT11663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]