SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT13166 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT13166
Domain Number 1 Region: 183-278
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.65e-17
Family B3 DNA binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT13166
Sequence length 302
Comment pep:novel supercontig:GCA_000347335.1:Scaffold48639:12819:15674:1 gene:F775_04098 transcript:EMT13166 description:""
Sequence
MAAASTEPALPGGSPADEDAEAVVASDELRHLPDQALQARLQRMQASIHGGIAARLPDGG
RTYRRKLLAVRRELERRKGQAPALPATAPHSPSPLPSSQHPPPCQGGPPDDVGCKHIVES
SDVQGTSSLPDQVKDEQMETPVCPSKQLPDAHIIKPKVEPCDDTLSPAPDASEDCETTPL
SCSHPFFTIILSRSHVQKPFQLYIPGRFHKHLPEERTSATLICRGRSWAMRYCGDLKTKR
LDADWMDFAVDNRLQVNDACVFELVTGTREEVVFQVQILRGGLPKDITSKGYTADEPLVI
VG
Download sequence
Identical sequences R7W235
XP_020175391.1.58150 EMT13166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]