SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT13424 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT13424
Domain Number 1 Region: 369-388,442-481,513-654
Classification Level Classification E-value
Superfamily HAD-like 1.86e-30
Family Meta-cation ATPase, catalytic domain P 0.002
Further Details:      
 
Domain Number 2 Region: 178-263
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 6.8e-18
Family Calcium ATPase, transduction domain A 0.011
Further Details:      
 
Domain Number 3 Region: 106-158,265-364
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000000000602
Family Calcium ATPase, transmembrane domain M 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT13424
Sequence length 695
Comment pep:novel supercontig:GCA_000347335.1:Scaffold47886:44700:52418:-1 gene:F775_28296 transcript:EMT13424 description:""
Sequence
MRMARAIGWADVADALREHLQLCCISLALLLMAAVCPHVPLLNSVGRLPAALIAVAFPLV
GAAYQVYQQTADQHRNILKIKIENEEVSAALDALVDIADGKINIHVLMALAAFASIFMGN
SLEGGLLLAMFNLAHIAEEYFTSKSMYDVRELKENHPEFALLLETSGDESAHFSNLNYAK
VPVHDLEVGSHILVRAGEAVPVDGEVYQGSSTITIEHLTGETKPVERTVGDAIPGGARNL
EGMMIVKVTKSWEDSTLNRIVQLTEEGQLNKPKLQRWLDEFGEHYSKVVVALSLAVALLG
PFLFNWPFFGNSVCRGSIYRGLGLMVAASPCALAVAPLAYATAISSLASKGILLKGGHVL
DALSSCQSIAFDKTGTLTTGKLMCKAIEPIHGHLDASNGVDPSCCTPNCESEALAVAAAM
EKGTTHPIGRAVLKHSVGRDLPVVAVESFESLPGRGVVATLSGIKARDNENEFAKASIGS
VEYISSLYRSYGESEQIKEAVKCSAFGPEFVQAALSVDKKVTLFHFEDEPRTGVCEVIYT
LREKAKLRIMMLTGDHESSAQRVAKAVCIEEVHFSLKPEDKLNKVKAVSREGGGGLIMVG
DGINDAPALAAATVGIVLAQRASATAVAVADVLLLQDNLCVVPFCIAKARQTTSLVMPLV
SSMWKTYRYNIAGSYNFEVHPYRFFSMKEEPFSFA
Download sequence
Identical sequences R7W7Q9
EMT13424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]