SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT14114 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT14114
Domain Number 1 Region: 348-422
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000053
Family B3 DNA binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT14114
Sequence length 662
Comment pep:novel supercontig:GCA_000347335.1:Scaffold45620:19386:25141:-1 gene:F775_00575 transcript:EMT14114 description:"B3 domain-containing protein "
Sequence
MGRHWVVPCGEPGWRDGGYDDPLASRCRRRAALGMDAFRSSSSSLSLTWCFLTSDPALFE
VSWSLAASLWSRSAGSLEAHNFWVLSVASGCRATALVVGTTMLVAQGLSGFHGRVDGVKA
GFRLFHGVGVVHLVVGRTLIEGRAGHFSNCAPRKRGRPAGGGGGSPSANKSQRDKMVMEQ
KMALVHQRLALLDSESDKDADVVPTATMDDKLAAVVVDQQPVVINFGDTDDEDEYVPLRI
VRPRRLDSEKEKLLDVSQTHNAQGTDTAKKKRGRLVKAQSNMEQKLKLSTPRLALVESGC
SNSSKSDIDEDHVPMVAAVNCKKTCSSVQGNFGSAMERAEEVLVKLPAEHPSFVKHMLHS
HVVQGFWLGLLSGFCNKHLPKQDATIVLEDEDGHNYDAKYLGAKQGLSGGWRGFAINHDI
KVYILRANNFTTTDGALGLLCLEAGKENILKEEGSNDVKSKENPKVQNDSSNPASESMKE
GIRFSDTAIDFDDVKNFSNFNIIVDGLVIDCKFPDHLRKTYYELCCAQESFLHKDLLKQI
NLTLAVGVIMETTNIAEGIRACEARASSHEDFVVWKKTLEAFELLGMNVKFLLKRIDGLL
SLSARPRDPAEHEGYKEMKLERAHAGAKMKELESRMSSVKDTLKKMDVEMEEMLRRLATA
PW
Download sequence
Identical sequences N1QWM7
EMT14114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]