SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT14989 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT14989
Domain Number 1 Region: 23-87
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000235
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT14989
Sequence length 123
Comment pep:novel supercontig:GCA_000347335.1:Scaffold42989:11448:11819:1 gene:F775_22546 transcript:EMT14989 description:""
Sequence
MAASFIINWSCPDLLCFLRRTVQIIPTHFQRRLPARRAAVVLRCRGSSWILSYCGDTKLK
RLDQGWEDFAVHNRLQVGDACVFELVSGYAGDGGKREVVACRSPRISPPKETPPTSPSWT
SHP
Download sequence
Identical sequences R7WAA7
EMT14989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]