SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT15692 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT15692
Domain Number 1 Region: 130-235
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.53e-16
Family B3 DNA binding domain 0.0074
Further Details:      
 
Domain Number 2 Region: 9-110
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000902
Family B3 DNA binding domain 0.014
Further Details:      
 
Domain Number 3 Region: 299-379
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000011
Family B3 DNA binding domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT15692
Sequence length 486
Comment pep:novel supercontig:GCA_000347335.1:Scaffold40811:30841:36618:-1 gene:F775_24284 transcript:EMT15692 description:"Putative B3 domain-containing protein "
Sequence
MALSVRRQPRYKFAAPVLSPSCLQKLCVPWEFAARLAAGAGDVHVVDLLGKPRRVELCVR
PRPDGGVACWLGAGWPEIVRKNGIGEGWSVVLRRERRGMATLTAFDPACCLVRLCAPPAG
RGRGVTSKTRPRFIKLLRPDDWEKMTIPDEFVQQHLIGLESCPSSQKALIIGPTGKLWPV
ELDQRQSDVLYGEVWAEFLTAHDLSQGNILLFRYEVNMSFSVQVFLPNGCMKEYPYLADE
ADGPSTALPQSAKQLVAATVSKKRKYNRQVVSAIPAPVPAIKAKKVESQSKPAGVLRGHS
FTKQITSSSLTKLFAVKRTFCSSIGLVGACTIELKTSMESTRSWPVAFNIANTYGYLTGK
GWKRFCRDNECEQNIVPVFCLPMPMSLANDSSCSAGYSLGKEINANLACRQAPVNLLKNG
KPLLGEKSIPSYLYYQNNQEPGVLSLEEGAGTCKGPMNCHKSLARSYLGKGTSAIAGFDT
PQVDDG
Download sequence
Identical sequences N1R3C5
EMT15692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]