SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT15755 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT15755
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily PapD-like 3.66e-37
Family MSP-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT15755
Sequence length 295
Comment pep:novel supercontig:GCA_000347335.1:Scaffold40593:42422:44372:-1 gene:F775_20454 transcript:EMT15755 description:"Vesicle-associated membrane protein-associated protein A "
Sequence
MVGGALISVYPDDLTFLFELDKPCYCNLKVVNNSEHHVAFKVKTTSPRKYFVRPNASVVQ
PWDSCTITITLQSQKEYPPDMQSKDKFLIQSTRVAASTDMDEIPPDTFNKEADKVIEEMK
LKVVYTLPSGSSDDSGVTSSANRSFKQGGDDLSMLKNASIEESCKYYFSLRFLNAEANTR
YLFLYKIMKRANMGNRTMFKHHQIIVEISVKLVEREKRYLYFQAGVIIEVGRDAQKPIQT
IQRLKDERDNNLQQNQQMQRELVLYIDLFTLHVVSTHCFSSVQLLVCLSILTFGF
Download sequence
Identical sequences N1QY14
EMT15755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]