SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT16511 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT16511
Domain Number 1 Region: 135-224,363-411,441-501
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 6.28e-26
Family Calcium ATPase, transmembrane domain M 0.028
Further Details:      
 
Domain Number 2 Region: 220-289,321-358
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.0000000000837
Family Calcium ATPase, transduction domain A 0.011
Further Details:      
 
Domain Number 3 Region: 494-534
Classification Level Classification E-value
Superfamily HAD-like 0.0000137
Family Meta-cation ATPase, catalytic domain P 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT16511
Sequence length 559
Comment pep:novel supercontig:GCA_000347335.1:Scaffold38266:64310:66506:1 gene:F775_22892 transcript:EMT16511 description:"Phospholipid-transporting ATPase 1 "
Sequence
MRPDGKLPPPHPSLAPLPQRPQQATGTDMDPHARLPDPVPSPILKHSPSISRSLRSAADT
SSVTFAADFRSPSKPESTSPSFDSFRTARSRPSSVSRSSTRRSASERAGSQRDLRDEDAR
FVYINDAPRTNAPPAMFPDNSIRTSKYSVLTFIPRNLYEQFHRVAYIYFLILAVLNFVPQ
LLVLSKEAGVLPLAFVLGVTAVKDAYEDWRRHRSDKNENNRTASVLADGVFRPKRWKDIQ
VGDVVRLVANETLHMVLVSTSDPTGVAYIQTINLDGESNLKTRYAKQETMSTPPEALAGV
IKCEKPNRNIYGFLATVDLNGRRAISLGTSNVMLRGCELKNTVWAIGVAVYTGRDTKVVL
NSSGAPSKRSRLETHMNREIIALAVALVVLCSVVSLLAGIWMGDHVDQLGIIPFFHKYDY
SGAAAHDDGRYNWYGTGAQVVFTFMSAVIQFQVMIPIGLIISMELIRVGQAYFMVQDNRM
FDEKSQARFQCRALNINEDLGQIKYVFSDKTGTLTQNRMEFRCASVQGRDFSETDGGEED
GHAVQGSSRMTQLRVTDQG
Download sequence
Identical sequences N1R1L2
EMT16511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]