SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT18852 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT18852
Domain Number 1 Region: 512-603
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000149
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT18852
Sequence length 610
Comment pep:novel supercontig:GCA_000347335.1:Scaffold31556:79113:84345:-1 gene:F775_14047 transcript:EMT18852 description:""
Sequence
MMNFTEDAPVNKGSVLLTRMESITAYKNQRGQPRSGTPEQSDTPVSANDMCPLAEWPSHA
RRNCALLQDEAGGQKKKGRGVLKGFKASKKRFANGSAKLNITFSGKLGGIVGMNYRSFKD
DVVVIMKRKLPLIGVRTWSDIHPTIHGLIVADMIDIWDLEDTPETEEKVLKIAKERYRGW
RSTLSSTYKAYKTDAARLANLPEDLQPEEWEWMIEYFGTDSKFQDRSQENADNRKKQKTK
HIIGSKSYSQVSFEKRNLETGEEPDCIALWELTHTNDGTWSNTDSQKVYDKALQEVKIKE
TEIEGPLSSEQKNNIFQTAYKDTLECKSSLPRGYGYMAKTSTGSERFRIQIEEQARATAA
TQEQNSQLSQQVPTKRVDKENSNPNLQNILLQRSSLNKTPGSRPTAISSNALIQAAARHS
RMVKAMVFVAMAPGPCANLSCCGHGCGVPTHCDCSACSQARRARRGGKVLCRAGRAEQLA
YGTIFTEKFDMGHTNVSAFYSTLLRRGLGRTSPFVHQVTPTDVETHYKMKIPQRAVWYLQ
LKKKGILQVVLGNGHLKPAKYRVGVDGRLCLQKGWKEFVTDSGLMSEQVVVLNFFELEDR
TVRITFDVIG
Download sequence
Identical sequences R7W9I3
EMT18852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]