SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT20145 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT20145
Domain Number 1 Region: 171-258
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000108
Family B3 DNA binding domain 0.01
Further Details:      
 
Weak hits

Sequence:  EMT20145
Domain Number - Region: 18-88
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000726
Family B3 DNA binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT20145
Sequence length 270
Comment pep:novel supercontig:GCA_000347335.1:Scaffold28540:68355:69778:-1 gene:F775_28370 transcript:EMT20145 description:"Uncharacterized protein "
Sequence
MKGTVGRGGVAIDISIRVLLPCSVTERFPKHFASDFLNFRAHGHRYVVYVYTGSDNKKRI
GGDDLSKFMKDFNLGLGQLVVFVMTGCIAKAFVCSFGAGFIDGGGAGVAQQEEEQGGADE
EGHVDEEGIDVEIMGEAPIGIIYSMGVSLDLEEEGRLAMMIDIEQGNIASRFVHRFTSTN
IMKKSMKIPNQVCVLLNIGAEGFIGVRLGEGPLSRVAFKTAKDGRMVFNKEWGVFVSTYN
LQVGSAAVFTFSRSNAAPFDVVCVVDILSI
Download sequence
Identical sequences N1R2L3
EMT20145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]