SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT20640 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT20640
Domain Number 1 Region: 351-741
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.05e-96
Family Regulator of chromosome condensation RCC1 0.00065
Further Details:      
 
Domain Number 2 Region: 110-211
Classification Level Classification E-value
Superfamily PH domain-like 3.62e-25
Family Pleckstrin-homology domain (PH domain) 0.0059
Further Details:      
 
Domain Number 3 Region: 740-808
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.08e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0028
Further Details:      
 
Domain Number 4 Region: 69-109
Classification Level Classification E-value
Superfamily PH domain-like 0.00000635
Family Pleckstrin-homology domain (PH domain) 0.043
Further Details:      
 
Weak hits

Sequence:  EMT20640
Domain Number - Region: 953-1013
Classification Level Classification E-value
Superfamily Tropomyosin 0.0556
Family Tropomyosin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT20640
Sequence length 1170
Comment pep:novel supercontig:GCA_000347335.1:Scaffold27121:108526:114938:-1 gene:F775_06239 transcript:EMT20640 description:""
Sequence
MSDASSDLGGARAGPLPVVERDLEQVQPRIVNFALVSVSARLLAGRLGGCNRGRADRYFW
RSMFVSVSAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGNTALKKGAYLLKY
GRRGKPKFCPFRLSNDESVLIWFSGKEEKHLRLSHVSRIMPGQRTAIFQRYPRPEKECQS
FSLISHDRSLDIICKDKDEAEVWFAGLKTLISRSHQRKWRTGSRSDTISSAATSPRTYTR
QSSPLSSPFSSSDSLHKDFNENYRFRSPYGSPPKNGLEKAFSDVALYAAPPRGFFPSDSN
AASVHSMSSGQSDNTNGNSGGIPMDAFRISYSSAVSSSSHGSGYDDGDALGDVLIWGEGT
GEGILGGGNSRIGSSSGAKIDCLVPKPLEFAVRLDVQNISCGGRHAALVSKQGEIYSWGE
ESGGRLGHGVDCDVAHPKLIDALTHMNIELVACGEYHTCAVTLSGDLYTWGDGAFKFGLL
GHGNDVSQWVPKKLHGPLEGIHVSSISCGPWHTAIVTSAGQLFTFGDGSFGVLGHGDRES
LSVPKEVESLKGLRTVRAACGVWHTAAVVEVMVGNSSSSNCSSGKIFTWGDGDKGRLGHG
DKESRLVPTCVAALVEPNFCQVACGHSLTVALTTSGNVYTMGSAVYGQLGNPQADGMLPV
RVEGKLHKNFVEEISCGAYHVAVLTSKTEVYTWGKGANGRLGHGNTDDKNTPTLVEALKD
KQVRSVVCGTNFTAAVCIHKWVSGVDQSMCSGCRQPFNLRRKRHNCYNCALVFCHSCSSK
KSLKASLAPNQSKPYRVCDSCYSKLTKGPGSDMYPSAKQGAVVQGFSDTVDEELETRSNA
KLSRISSMESFKNMDSRYSKKNKKFEFNSTRLSPVPNGGSRSFNPVFGSSKKFLSASVPG
SRIISRATSPVSRRSSPPRSITPTPTLRSLTSPGGVINGTKPTNDSQTQEVLSLKSQVDN
LTRKSQHLELELERTTKQLKEAIAIAGEETAKCKAAKEVIKSLTVQLKGMAERLPGGVAK
NGKLPPLPGIPIPSDISAIVTESLGSPGSSGEQEQISDDPNGLLVSNGSNSVRNKEGHPE
MTNNGSVPPDAESHHEAEWVEQDEPGVYITLTALPGGARDLKRVRFSRKRFSETQAEQWW
QGNRARVYQQYNVHMVDKSVAAMDRDIATH
Download sequence
Identical sequences R7WG54
EMT20640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]