SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT20664 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT20664
Domain Number 1 Region: 301-691
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.11e-97
Family Regulator of chromosome condensation RCC1 0.00075
Further Details:      
 
Domain Number 2 Region: 62-161
Classification Level Classification E-value
Superfamily PH domain-like 2.35e-24
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 
Domain Number 3 Region: 690-758
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 8.15e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0022
Further Details:      
 
Domain Number 4 Region: 19-63
Classification Level Classification E-value
Superfamily PH domain-like 0.00000107
Family Pleckstrin-homology domain (PH domain) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT20664
Sequence length 1115
Comment pep:novel supercontig:GCA_000347335.1:Scaffold27064:37421:44419:-1 gene:F775_05691 transcript:EMT20664 description:"Putative E3 ubiquitin-protein ligase HERC1 "
Sequence
MSDASSDLGGGRAGPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESILIWFS
GKKGAYLLKYGRRGKPKFCPFRLSNDESILIWFSGKEEKQLRLSHVSRIIPGQRTAIFQR
YPRPEKECQSFSLISHDRSLDIICKDKDEAEVWFAGLKTLISRSHQRKWRTESRSDMLSS
GTTSPRTYTRRSSPLSSPFSSNDSVHKDGSENYRLRSPYGSPPKVGLDKAFSDIVSYAAP
PRPFFPSDSNVGSVHSVSSGHSDNTNGNSRGIPMDAFRVSLSSAVSSSSHGSGHDDGDAL
GDVFIWGEGTGEGILGGGNSRVGSSSGAKMDCLVPKPLEFAGRLDVQNISCGGRHATLVT
KQGEVYSWGEESGGRLGHGVDCDVPQPKLIDALAHMNIELVACGEYHTCAVTLSGDLYTW
GNGTFNFGLSGHGNEVSHWMPKRLNGPLEGVHVSSISCGPWHTAVVTSAGQLFTFGDGSF
GVLGHGDRQSISVPREVESLKGLRTVRAACGVWHTAAVVEVMVGNSSSSNCSSGKIFTWG
DGDKGRLGHGDKETRLVPTCVASLVEPNFCQVACGHCFTVALTTSGHVYTMGSSVYGQLG
NPQADGMVPARVEGKLHKNFVEEISCGAYHVAVLTSRTEVYTWGKGANGRLGHGDTDDRN
SPTLVEALKDKQVRSVVCGINFTAAICIHKWVSGVDQSMCSGCRLPFNLRRKRHNCYNCA
LVFCHSCSSKKSLKASLAPNPNKPYRVCDSCYGKLNKGPETDRYSSAKRGAILQGFNDSI
NDDSETRSNVQLSRLSSMESFKNMDSRYSKKNKKFEFNSSRVSPIPNGSSHWSGLNISKS
FGSSKKFFSASVPGSRIASRATSPVSRRTSPPRSTTPTPTLGGLTSPRVVVDGTKPIKDS
VENLTRKSHLLEVELERTTKQLKEAISIAGEETAKCKAAKEVIKSLTAQLKGMAEKLPEG
AGAGAGAGVVKHSRLPPLSGVPVNDISMATENLGSPRNSGEPYLNGSNGLIVSNGPSSVR
NKTHLEVGKNGTRQPDSDSKPDSEWVEQDEPGVYITLTALPGGARDLRRVRFRTDFRTHF
LSAGHEGSKKNCNDFVKSTLPLRNWDVSRWQPLAH
Download sequence
Identical sequences N1R0V7
EMT20664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]