SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT21698 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT21698
Domain Number 1 Region: 430-505,588-731
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.96e-37
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0061
Further Details:      
 
Domain Number 2 Region: 54-145
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000275
Family Domains B1 and B5 of PheRS-beta, PheT 0.0062
Further Details:      
 
Domain Number 3 Region: 319-381
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000811
Family B3/B4 domain of PheRS, PheT 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT21698
Sequence length 731
Comment pep:novel supercontig:GCA_000347335.1:Scaffold24660:21654:30181:1 gene:F775_26914 transcript:EMT21698 description:"Putative phenylalanyl-tRNA synthetase beta chain "
Sequence
MPTVSVGRDRLFAALGRVYTQDEFEALCFDFSSRVPPPASDTPPQPPLAMPTVSVGRDRL
FAALGRVYTQDEFEALCFDFGIELDDVTTEKAIIRKEKHLEEDVEADGDDEVIYKIEVAA
NRYDLLCLEGIARSLRIFTGSEATPIFKIASIPRGSMLQMHVRSQTSQIRPYVVCAVLRG
VTFDEVRYNSFIDLQDKLHQNICRKRTLVAIGAHDLDTLQGPFSYEGYRNKGHAVVHLID
FARIHGASSCQGCSLLAPKAPFRCLWPCFGEIQALPPQEINFIPLKQEQNFRADALMEFY
RSDMKLKKFLHIIENSPVYPVIYDSNRTVLSLPPIINGAHSAITLKTRNVFIECTATDLT
KANIVLNTMVAMFSEYCENKFGVEPVEVVSYDGSTAIYPDLSCYKMEVALSDIIGPIGIS
LDETQDVAIAYGYNNVPKSKPKSMTIGGRQPLNRFSDKIRADVARAGYMEVLTFVLTSHE
ENFDMLNRTDDGNKAVIIANPRTSEFERRPPEAPVHSRRLKRAENVKRGRGRPNLTWEES
VKRDLKDWSITKELAMDRDCHHTPGICGLSYLAVFTYLLQNKSIHFVSNVVRSSLMSCLL
KTLKHNIDHPRPIKIFEVGDVVSLDTSRDVGASNNRRLAALYCNSNSGFEEIMGLVDRIV
KIVTHSPRIKFGQTYYVPSSEPEFFTKRQCKIVTSDGKQVGYLGIVHAEVLRKFGIPDPC
TFVEIDIEALL
Download sequence
Identical sequences M8BIX8
EMT21698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]