SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT22227 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT22227
Domain Number 1 Region: 82-368
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.43e-90
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.0000000318
Further Details:      
 
Domain Number 2 Region: 34-81
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000165
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT22227
Sequence length 420
Comment pep:novel supercontig:GCA_000347335.1:Scaffold23508:10923:15083:-1 gene:F775_27576 transcript:EMT22227 description:"Pyruvate dehydrogenase E1 component subunit alpha, mitochondrial "
Sequence
MAATRLISDSTAPLTIETSMPFTAHIVDPPSRDVATTPAELVAFFHDMSLMRRMEIAADS
LYKAKLIRGFCHLYDGQEAARLIRGFCHLYDGQEAVCAGMEAAITRKDSIITAYRDHCIF
LSRGGDLVTAFAELMGRQVGCSRGKGGSMHFYKKDANFYGGHGIVGAQVPLGCGLAFAQK
YRKEDTVSFSLYGDGAANQGQLFEALNISALWKLPAILVCENNHYGMGTAEWRAAKSPSY
YKRGDYVPGLKVDGMDVLAVKQACKFAKEHAIANGPIVLEMDTYRYHGHSMSDPGSTYRT
RDEISGVRQERDPIERVRKLLLAHDLATPAELKDMEKEIRKEVDAAIAKAKESPMPDASE
LFTNVYVKGFGVEHPIATLPETLNDYPLAGLGITEEIWHLSYDCGTMGFVTFDGIIILET
Download sequence
Identical sequences M8C5D6
EMT22227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]