SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT23621 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT23621
Domain Number 1 Region: 303-412
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-20
Family B3 DNA binding domain 0.0024
Further Details:      
 
Domain Number 2 Region: 155-254
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.9e-19
Family B3 DNA binding domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT23621
Sequence length 1124
Comment pep:novel supercontig:GCA_000347335.1:Scaffold20401:65472:71368:-1 gene:F775_06996 transcript:EMT23621 description:"B3 domain-containing protein "
Sequence
MYQTPPYPGAAEGAVPSSLMDTPLTEERRAARRVRRRVCSSGSPTSLNHGESDDAQEMST
NSTEISSSDCYTQLSSESSDEGCENRSSGHRRKRRKTSVISSASEQSGQDSPSACESLES
DDVQITPGKDYVLPQRCDLSDAEKNRVVALIKEIKAKVTVFVAIMLRSYSSYVTIPKEYA
AVHFPPESATITLRSPGKNKKWHPRFYKKGTMIKLTGSWLHFVRDNDVHEGDICIFVPAK
GGKPFMFTVHLLRKETTDSQTEVSHESSECEDSHGQPPYILPYGARLSPSQRSAVKKKVD
SIQSEVPIYVSIMTKSNLGSRHMVELSKRYAAEHLPHRNVTLMFQYMGKIWNINMLFHDR
KYPKRWYLIGGWSKFISDNSLRLGDICLFELKKDEKELTVIVHLLRKESIDHPSGVSPVL
DSNYVRASTMIASTVHVGEEPDDEEETASSGREEQGFDDEPIEHNYSEGASKAHMPTAPC
SESNASGISPSPEAREQAAGCSNKSFATEFPNKPSSTMEHNRIIHTDRAAASEVIGLSDY
RIHNSCDSIDSQGGESLAVQQQSSPSPGIGNSVNPLTVCLSLRCFVEPCGVHFLSFCKYF
IFMLLYCILRTFQNNSLYDMYQDSSSGDHRSAERVEGESDVALQSLVRVTGQQVGDAEKE
VNASGGENSLADLPHLEPQNVAAVPSQAALPMPKEKTDTQTNRSAQPDVAQAQPPQGEVE
QAGLSGVASPQPLQPAQLAQREAEQDLSGVASPSQPETRPSISGFVETRSNLVTQSVEQS
IAPVQFPQEQAGLSGVASAQPLVPEMQPSTPLSNIPLERAHPNRGQSSRQPEAAAGSAQP
AQLFPAPSMMFNHPPIGDEPLKNELHRLRLHIDSLDKIYELKQSQLQTECSQEIEKIKQK
YDLLLEEQDSVHLEQMKTLDGLLEKVVFHQSLAADFRAKFISPSAAQAKAYSRPIHQTPQ
ASQQAPMRPPGMTSTSPPAAWSSAGRPVVPGGAQPSQVDRPSTPASSQAPRPPLPSTPVV
RLPINPGNLVRTTGAPMPRVPPRGSHGVPSAPAPHLQCRLPPRAHSTAPANQRQQQHATS
VSPQSSHAVPPVSSSPLPPSSSQATHHGSSTRMDVDVVCLSDDE
Download sequence
Identical sequences M8CJU1
EMT23621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]