SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT24022 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT24022
Domain Number 1 Region: 109-201
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.12e-17
Family B3 DNA binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT24022
Sequence length 329
Comment pep:novel supercontig:GCA_000347335.1:Scaffold19493:159054:164188:-1 gene:F775_31589 transcript:EMT24022 description:"B3 domain-containing protein "
Sequence
MAEANSYEEQRRRQVEENKRKLEELRLHHLSAAVREAAVKPRLKRKAPKPRDAADDAPPR
RSGRIATLPEQPDYRDNVKLGTRKPWQQKEVKPDHAYAIAKAEELQDELGSDYPTFVKPM
PQSLTSLHIPAQFSMEHLPDHGMRMVLVDEEEEEFKVCYRPHSSSLVAGWSEFAVDNELV
EGDCLVFQLIKRALFKYTSRCASFIFHMKKVPKKCNSFSYEESAEKDGARYNITQSNTAC
EAKWTSHAPVVESRPWVLTSQLSALGTPFRKLCLVIHNTKSTYSGQVRTMKMTINEAAGR
LLVASCQLLLNFHSSEIRTMSGVKWEAEK
Download sequence
Identical sequences M8CAC1
EMT24022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]