SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT25671 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT25671
Domain Number 1 Region: 132-228
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000194
Family B3 DNA binding domain 0.011
Further Details:      
 
Weak hits

Sequence:  EMT25671
Domain Number - Region: 20-86
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00275
Family B3 DNA binding domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT25671
Sequence length 461
Comment pep:novel supercontig:GCA_000347335.1:Scaffold15677:15688:19059:1 gene:F775_00733 transcript:EMT25671 description:"Uncharacterized protein "
Sequence
MVTDAYKMSNPCECCQSKLKFIRQINRNFMHSMVLPEWFVNQLGGKIWRTIKLQAPNGII
YDVGVTENMNRIILKLGLSCVIRFFSYSPLHWSLTIEDFVTAEDNSVESDDLQKLSNYYV
LSGQCYLTESQEMKKSNVKQGPTLVIRKDYALEHLPCKDTNIILQLPRKNKDWHCRFTIR
PSGTSDAGRRNLSLGNFVHDNHVREGDIYLFEPMANAKQKRFTMIAHLLHKESIDHSPGA
RTDIGSNHGRTSKKMAVAMVEPPTDGEEYSSEHEELGVPDDSEGGSEPPFMLPDKSCLTP
AQKEKVFEKVNEIKSELPLYVAVMSKSNVCRGGSYNSPVLMGTNFHVSPSLRHSNIFPVL
PYINSASARNTQADILFRSLLLAIIVERIDIYNFGAPAGGEEQIMDYQCATQHATHSAYN
EGSQRMDLFRPRQPPEGGGPLSLQADEEQGASDYDGLHHSP
Download sequence
Identical sequences M8CPZ8
EMT25671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]